|
Overview
Name | Tc09v2_p023970.6 |
Unique Name | Tc09v2_p023970.6 |
Type | polypeptide |
Organism | Theobroma cacao (cacao) |
Sequence length | 137 |
Properties
Property Name | Value |
Note | Tc09v2_g023970~ Putative Histidine-containing phosphotransfer protein 2~ unknown_gene~ complete |
Product | histidine-containing phosphotransfer protein 2-like isoform X6 |
Cross References
External references for this polypeptide
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >Tc09v2_p023970.6 ID=Tc09v2_p023970.6|Name=Tc09v2_p023970.6|organism=Theobroma cacao|type=polypeptide|length=137bp MAVPIQKVLLTGFIHSMHSEEIVDDQFYQPEAIKDPACLYCWRRGCIISL SDLPNVDFSNLAALATEIEERSSCIGAEHVRLTCLDLMRACDQMQKQNFC QALSWTKNEFAHTRNKLQVLVQMERKIMRLEAKQQK* back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
Term | Definition |
complete | complete |
Vocabulary: CC Evidence Code
Term | Definition |
IC_3 | IC_3 |
Vocabulary: Genedb Products
Term | Definition |
Putative Histidine-containing phosphotransfer protein 2 | Putative Histidine-containing phosphotransfer protein 2 |
Vocabulary: Molecular Function
Term | Definition |
GO:0004871 | signal transducer activity |
Vocabulary: Biological Process
Term | Definition |
GO:0000160 | phosphorelay signal transduction system |
|