Tc09v2_t007470.2
| Overview 
 Properties 
 Cross References External references for this mRNA 
 Relationships This mRNA is a part of the following gene feature(s): 
 The following polypeptide feature(s) derives from this mRNA: 
 The following exon feature(s) are a part of this mRNA: 
 The following CDS feature(s) are a part of this mRNA: 
 Sequences The following sequences are available for this feature: mRNA sequence >Tc09v2_t007470.2 ID=Tc09v2_t007470.2|Name=Tc09v2_t007470.2|organism=Theobroma cacao|type=mRNA|length=378bpback to top protein sequence of Tc09v2_p007470.2 >Tc09v2_p007470.2 ID=Tc09v2_p007470.2|Name=Tc09v2_p007470.2|organism=Theobroma cacao|type=polypeptide|length=126bp MKRRTCYFLIVALHIISWILASTRSLASHDVAPQQDKVPEFKGGPIDSKQback to top |