|
Overview
Name | Tc03v2_p019870.1 |
Unique Name | Tc03v2_p019870.1 |
Type | polypeptide |
Organism | Theobroma cacao (cacao) |
Sequence length | 111 |
Properties
Property Name | Value |
Product | phospho-2-dehydro-3-deoxyheptonate aldolase 1, chloroplastic |
Note | Tc03v2_g019870~ Phospho-2-dehydro-3-deoxyheptonate aldolase 2, chloroplastic~ unknown_gene~ fragment |
Cross References
External references for this polypeptide
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >Tc03v2_p019870.1 ID=Tc03v2_p019870.1|Name=Tc03v2_p019870.1|organism=Theobroma cacao|type=polypeptide|length=111bp MHGNTFTALCGRKTRGFDAIRAELRAFFDVHDQEGSYPGEVHLEMTGQNV TECVGGSMTVAFDDLSSRYHTHCDPRLNASQSLELAFAISERLRRRLESA NKFRGAYRCN* back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
Term | Definition |
fragment | fragment |
Vocabulary: CC Evidence Code
Term | Definition |
IC_2 | IC_2 |
Vocabulary: Genedb Products
Term | Definition |
Phospho-2-dehydro-3-deoxyheptonate aldolase 2, chloroplastic | Phospho-2-dehydro-3-deoxyheptonate aldolase 2, chloroplastic |
Vocabulary: Molecular Function
Term | Definition |
GO:0003849 | 3-deoxy-7-phosphoheptulonate synthase activity |
Vocabulary: Biological Process
Term | Definition |
GO:0009073 | aromatic amino acid family biosynthetic process |
|