|
Overview
Name | Tc10v2_p011470.4 |
Unique Name | Tc10v2_p011470.4 |
Type | polypeptide |
Organism | Theobroma cacao (cacao) |
Sequence length | 135 |
Properties
Property Name | Value |
Note | Tc10v2_g011470~ Putative Glucan endo-1,3-beta-glucosidase, basic vacuolar isoform GLB~ unknown_gene~ fragment |
Product | uncharacterized protein LOC18587111 |
Cross References
External references for this polypeptide
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >Tc10v2_p011470.4 ID=Tc10v2_p011470.4|Name=Tc10v2_p011470.4|organism=Theobroma cacao|type=polypeptide|length=135bp MKKTKVQPESTSMVQPEEKIGEGEDVKNREDNISRDSGGFSNSYGTNLSL YTTEKRWYRVGLLEMNERDEQVALLLDVLKCICLFQAYMTYAQAQKFHAQ EEVKYVAIVSPSDNVQSAKRTKSGILEGRPKSKK* back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
Term | Definition |
fragment | fragment |
Vocabulary: CC Evidence Code
Term | Definition |
IC_3 | IC_3 |
Vocabulary: Genedb Products
Term | Definition |
Putative Glucan endo-1,3-beta-glucosidase, basic vacuolar isoform GLB | Putative Glucan endo-1,3-beta-glucosidase, basic vacuolar isoform GLB |
|