|
Overview
Name | Tc09v2_p029180.1 |
Unique Name | Tc09v2_p029180.1 |
Type | polypeptide |
Organism | Theobroma cacao (cacao) |
Sequence length | 118 |
Properties
Property Name | Value |
Note | Tc09v2_g029180~ SNF1-related protein kinase regulatory subunit beta-3~ unknown_gene~ complete |
Product | SNF1-related protein kinase regulatory subunit beta-3 |
Cross References
External references for this polypeptide
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >Tc09v2_p029180.1 ID=Tc09v2_p029180.1|Name=Tc09v2_p029180.1|organism=Theobroma cacao|type=polypeptide|length=118bp MNNQFGEDQDEATVMGFEVPKSPDSSYNNVYPGNEDDARDPPVVPAHLHR TLLSYPTSMNASGNLPLPENVILNHLYIENREAPRSVVALGFTHRFRSKY VTVVLYKPVPRRGSAST* back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
Term | Definition |
complete | complete |
Vocabulary: CC Evidence Code
Term | Definition |
IC_2 | IC_2 |
Vocabulary: Genedb Products
Term | Definition |
SNF1-related protein kinase regulatory subunit beta-3 | SNF1-related protein kinase regulatory subunit beta-3 |
Vocabulary: Molecular Function
Term | Definition |
GO:0005515 | protein binding |
Vocabulary: Biological Process
Term | Definition |
GO:0009744 | response to sucrose |
GO:0043562 | cellular response to nitrogen levels |
|