|
Overview
Name | Tc09v2_p010710.2 |
Unique Name | Tc09v2_p010710.2 |
Type | polypeptide |
Organism | Theobroma cacao (cacao) |
Sequence length | 138 |
Properties
Property Name | Value |
Note | Tc09v2_g010710~ Signal peptidase I~ unknown_gene~ fragment |
Product | signal peptidase complex catalytic subunit SEC11C isoform X2 |
Cross References
External references for this polypeptide
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >Tc09v2_p010710.2 ID=Tc09v2_p010710.2|Name=Tc09v2_p010710.2|organism=Theobroma cacao|type=polypeptide|length=138bp MKSTQIRQFLYQAVSLGMIIASALMVWKGLICITGSESPVVVVLTGSMEP GFKRGDILFLYMSKDPIRAGEIVVFNDGRKVPIVHRVIEVHERRDTREAD ILTKGDANDMDDRVLYTSSQHWLQQKYIKGRAVGTYF* back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
Term | Definition |
fragment | fragment |
Vocabulary: CC Evidence Code
Term | Definition |
IC_2 | IC_2 |
Vocabulary: Genedb Products
Term | Definition |
Signal peptidase I | Signal peptidase I |
Vocabulary: Molecular Function
Term | Definition |
GO:0008233 | peptidase activity |
Vocabulary: Biological Process
Term | Definition |
GO:0006465 | signal peptide processing |
Vocabulary: Cellular Component
Term | Definition |
GO:0016020 | membrane |
|