|
Overview
Name | Tc05v2_p018930.1 |
Unique Name | Tc05v2_p018930.1 |
Type | polypeptide |
Organism | Theobroma cacao (cacao) |
Sequence length | 128 |
Properties
Property Name | Value |
Product | uncharacterized protein LOC18599640 |
Note | Tc05v2_g018930~ Polymerase delta 4~ unknown_gene~ fragment |
Cross References
External references for this polypeptide
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >Tc05v2_p018930.1 ID=Tc05v2_p018930.1|Name=Tc05v2_p018930.1|organism=Theobroma cacao|type=polypeptide|length=128bp MATTSKNMKGFYRQKKNNSRGGITKSKSSKSTKNPSPSHAATFGSDITQP AALTSPGGSLDLKDDFDVQEEVSRHFDMNMAYGPCLGITRMARWERAQRL GLNPPKEIENLLKGGKVKLESLFDGRV* back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
Term | Definition |
fragment | fragment |
Vocabulary: CC Evidence Code
Term | Definition |
IC_2 | IC_2 |
Vocabulary: Genedb Products
Term | Definition |
Polymerase delta 4 | Polymerase delta 4 |
Vocabulary: Biological Process
Term | Definition |
GO:0006260 | DNA replication |
Vocabulary: Cellular Component
Term | Definition |
GO:0005634 | nucleus |
|