|
Overview
Name | Tc04v2_p001770.1 |
Unique Name | Tc04v2_p001770.1 |
Type | polypeptide |
Organism | Theobroma cacao (cacao) |
Sequence length | 129 |
Properties
Property Name | Value |
Product | transcription initiation factor TFIID subunit 13 |
Note | Tc04v2_g001770~ Transcription initiation factor TFIID subunit 13~ unknown_gene~ complete |
Cross References
External references for this polypeptide
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >Tc04v2_p001770.1 ID=Tc04v2_p001770.1|Name=Tc04v2_p001770.1|organism=Theobroma cacao|type=polypeptide|length=129bp MSNQSTGTSSKSKVGSSQPSETSFKRKRGVFQKDLQHMMYGFGDDPNPLP ETVSLVEDIVVEYVTDLAHKAQDIGSKRGKLSVEDFLYLIRKDLPKLNRS TELLSMQEELKQARKAFEVDEEKLGTTE* back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
Term | Definition |
complete | complete |
Vocabulary: CC Evidence Code
Term | Definition |
IC_2 | IC_2 |
Vocabulary: Genedb Products
Term | Definition |
Transcription initiation factor TFIID subunit 13 | Transcription initiation factor TFIID subunit 13 |
Vocabulary: Biological Process
Term | Definition |
GO:0006366 | transcription from RNA polymerase II promoter |
Vocabulary: Molecular Function
Term | Definition |
GO:0046982 | protein heterodimerization activity |
|