|
Properties
Property Name | Value |
Product | dolichol phosphate-mannose biosynthesis regulatory protein |
Note | Tc03v2_g025810~ Dolichol phosphate-mannose biosynthesis regulatory protein-related~ unknown_gene~ complete |
Cross References
External references for this polypeptide
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >Tc03v2_p025810.1 ID=Tc03v2_p025810.1|Name=Tc03v2_p025810.1|organism=Theobroma cacao|type=polypeptide|length=81bp MELADRVVGFLLSFISLSIFTYYTFWVIILPFVDSDNFIHKYFLPQEYAI LIPVCAGVVLLCLLCMFVGFVMLKSKKKKA* back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
Term | Definition |
complete | complete |
Vocabulary: CC Evidence Code
Term | Definition |
IC_1 | IC_1 |
Vocabulary: Genedb Products
Term | Definition |
Dolichol phosphate-mannose biosynthesis regulatory protein-related | Dolichol phosphate-mannose biosynthesis regulatory protein-related |
Vocabulary: Molecular Function
Term | Definition |
GO:0030234 | enzyme regulator activity |
Vocabulary: Biological Process
Term | Definition |
GO:0019348 | dolichol metabolic process |
Vocabulary: Cellular Component
Term | Definition |
GO:0030176 | integral component of endoplasmic reticulum membrane |
|