|
Properties
Property Name | Value |
Product | RNA polymerase II transcription factor B subunit 5 |
Note | Tc03v2_g021930~ RNA polymerase II transcription factor B subunit 5~ unknown_gene~ complete |
Cross References
External references for this polypeptide
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >Tc03v2_p021930.1 ID=Tc03v2_p021930.1|Name=Tc03v2_p021930.1|organism=Theobroma cacao|type=polypeptide|length=71bp MVNATKGLFISCDIPMAQFIVNLNASMPASQKFIIHVLDNTHFFVQPHAA EMIRSAISEFRDQNSYEKPT* back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
Term | Definition |
complete | complete |
Vocabulary: CC Evidence Code
Term | Definition |
IC_2 | IC_2 |
Vocabulary: Genedb Products
Term | Definition |
RNA polymerase II transcription factor B subunit 5 | RNA polymerase II transcription factor B subunit 5 |
Vocabulary: Biological Process
Term | Definition |
GO:0006289 | nucleotide-excision repair |
GO:0006355 | regulation of transcription, DNA-templated |
Vocabulary: Cellular Component
Term | Definition |
GO:0000439 | core TFIIH complex |
|