|
Overview
Name | Tc01v2_p034800.1 |
Unique Name | Tc01v2_p034800.1 |
Type | polypeptide |
Organism | Theobroma cacao (cacao) |
Sequence length | 100 |
Properties
Property Name | Value |
Note | Tc01v2_g034800~ Sm-like protein LSM7~ unknown_gene~ complete |
Product | sm-like protein LSM7 |
Cross References
External references for this polypeptide
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >Tc01v2_p034800.1 ID=Tc01v2_p034800.1|Name=Tc01v2_p034800.1|organism=Theobroma cacao|type=polypeptide|length=100bp MSGRKETVLDLAKFVDKGVQVKLTGGRQVTGTLKGYDQLLNLVLDEAVEF LRDPDDPLKTTDQTRRLGLIVCRGTAVMLVSPTDGTDEIANPFIQPDGA* back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
Term | Definition |
complete | complete |
Vocabulary: CC Evidence Code
Term | Definition |
IC_1 | IC_1 |
Vocabulary: Genedb Products
Term | Definition |
Sm-like protein LSM7 | Sm-like protein LSM7 |
Vocabulary: Molecular Function
Term | Definition |
GO:0003723 | RNA binding |
Vocabulary: Biological Process
Term | Definition |
GO:0000398 | mRNA splicing, via spliceosome |
Vocabulary: Cellular Component
Term | Definition |
GO:0005732 | small nucleolar ribonucleoprotein complex |
|