|
Overview
Name | Tc05v2_p005730.1 |
Unique Name | Tc05v2_p005730.1 |
Type | polypeptide |
Organism | Theobroma cacao (cacao) |
Sequence length | 138 |
Properties
Property Name | Value |
Product | histidine--tRNA ligase, chloroplastic/mitochondrial-like |
Note | Tc05v2_g005730~ Hypothetical protein~ unknown_gene~ missing_functional_completeness |
Cross References
External references for this polypeptide
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >Tc05v2_p005730.1 ID=Tc05v2_p005730.1|Name=Tc05v2_p005730.1|organism=Theobroma cacao|type=polypeptide|length=138bp MVDLLLNIFYLCSFGLLGVLLWMCLWLFWRCGDCGSKLLKEKGLLPELSL EVDNIVCALDYDLQGVAATVATKLRGKGQSVDLVLESKPLKWVFKRAARA NAERLILVGNTEWQKGMVGVKILSSGEQYEIKLDELE* back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
Term | Definition |
missing_functional_completeness | missing_functional_completeness |
Vocabulary: CC Evidence Code
Term | Definition |
IC_5 | IC_5 |
Vocabulary: Genedb Products
Term | Definition |
Hypothetical protein | Hypothetical protein |
Vocabulary: Cellular Component
Term | Definition |
GO:0005737 | cytoplasm |
|