|
Overview
Name | Tc05v2_p023360.3 |
Unique Name | Tc05v2_p023360.3 |
Type | polypeptide |
Organism | Theobroma cacao (cacao) |
Sequence length | 136 |
Properties
Property Name | Value |
Product | photosystem II reaction center W protein, chloroplastic |
Note | Tc05v2_g023360~ Photosystem II reaction center W protein, chloroplastic~ unknown_gene~ complete |
Cross References
External references for this polypeptide
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >Tc05v2_p023360.3 ID=Tc05v2_p023360.3|Name=Tc05v2_p023360.3|organism=Theobroma cacao|type=polypeptide|length=136bp MATITASNFAAVLPKATLKGSYKVQSSPVVGLPVMATNGRVRCTLEQKRS ASSMSLNPSVVASLMAAAAAAMTTTAGPAMALVDERLSTEGTGLPFGLSN NLLGWILFGAFGLIWALYFIYVSSLEEDEESGLSL* back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
Term | Definition |
complete | complete |
Vocabulary: CC Evidence Code
Term | Definition |
IC_2 | IC_2 |
Vocabulary: Genedb Products
Term | Definition |
Photosystem II reaction center W protein, chloroplastic | Photosystem II reaction center W protein, chloroplastic |
Vocabulary: Biological Process
Term | Definition |
GO:0015979 | photosynthesis |
|