|
Overview
Name | Tc02v2_p000920.1 |
Unique Name | Tc02v2_p000920.1 |
Type | polypeptide |
Organism | Theobroma cacao (cacao) |
Sequence length | 130 |
Properties
Property Name | Value |
Note | Tc02v2_g000920~ Photosystem I reaction center subunit psaK, chloroplastic~ unknown_gene~ complete |
Product | photosystem I reaction center subunit psaK, chloroplastic |
Cross References
External references for this polypeptide
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >Tc02v2_p000920.1 ID=Tc02v2_p000920.1|Name=Tc02v2_p000920.1|organism=Theobroma cacao|type=polypeptide|length=130bp MAATAMTTLPQFSGLRPRISAAPVRSLAAVQPMRRKGKGALGARCGYIGS PTNLIMVTTTSLMLFAGRFGLAPSANRKATAGLKLEARDSGLQTGDPAGF TLADTLACGSVGHIIGVGIVLGLKNIGAL* back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
Term | Definition |
complete | complete |
Vocabulary: CC Evidence Code
Term | Definition |
IC_2 | IC_2 |
Vocabulary: Genedb Products
Term | Definition |
Photosystem I reaction center subunit psaK, chloroplastic | Photosystem I reaction center subunit psaK, chloroplastic |
Vocabulary: Biological Process
Term | Definition |
GO:0015979 | photosynthesis |
Vocabulary: Molecular Function
Term | Definition |
GO:0016168 | chlorophyll binding |
|