Tc10v2_t000210.1
| Overview 
 Properties 
 Cross References External references for this mRNA 
 Relationships This mRNA is a part of the following gene feature(s): 
 The following polypeptide feature(s) derives from this mRNA: 
 The following exon feature(s) are a part of this mRNA: 
 The following CDS feature(s) are a part of this mRNA: 
 Sequences The following sequences are available for this feature: mRNA sequence >Tc10v2_t000210.1 ID=Tc10v2_t000210.1|Name=Tc10v2_t000210.1|organism=Theobroma cacao|type=mRNA|length=519bpback to top protein sequence of Tc10v2_p000210.1 >Tc10v2_p000210.1 ID=Tc10v2_p000210.1|Name=Tc10v2_p000210.1|organism=Theobroma cacao|type=polypeptide|length=173bp MSLVDYASSSDDDVSDSEREPPQQRHEPPPPPLPRAPSPPKTQASGSSADback to top |