|
Overview
Name | Tc08v2_p006400.2 |
Unique Name | Tc08v2_p006400.2 |
Type | polypeptide |
Organism | Theobroma cacao (cacao) |
Sequence length | 107 |
Properties
Property Name | Value |
Note | Tc08v2_g006400~ Transcription initiation factor IIA subunit 2~ unknown_gene~ complete |
Product | transcription initiation factor IIA subunit 2 |
Cross References
External references for this polypeptide
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >Tc08v2_p006400.2 ID=Tc08v2_p006400.2|Name=Tc08v2_p006400.2|organism=Theobroma cacao|type=polypeptide|length=107bp MATFELYRRSTIGMCLTETLDEMVSNGTLSPELAIQVLVQFDKSMTEALE SQVKSKVAIKGHLHTYRFCDNVWTFILQDAVFKYEDASETVGRVKIVACD SKLLSQ* back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
Term | Definition |
complete | complete |
Vocabulary: CC Evidence Code
Term | Definition |
IC_2 | IC_2 |
Vocabulary: Genedb Products
Term | Definition |
Transcription initiation factor IIA subunit 2 | Transcription initiation factor IIA subunit 2 |
Vocabulary: Biological Process
Term | Definition |
GO:0006367 | transcription initiation from RNA polymerase II promoter |
Vocabulary: Cellular Component
Term | Definition |
GO:0005672 | transcription factor TFIIA complex |
|