|
Overview
Name | Tc09v2_p012740.1 |
Unique Name | Tc09v2_p012740.1 |
Type | polypeptide |
Organism | Theobroma cacao (cacao) |
Sequence length | 111 |
Properties
Property Name | Value |
Note | Tc09v2_g012740~ Cytochrome b-c1 complex subunit 7-1~ unknown_gene~ complete |
Product | cytochrome b-c1 complex subunit 7-1 isoform X2 |
Cross References
External references for this polypeptide
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >Tc09v2_p012740.1 ID=Tc09v2_p012740.1|Name=Tc09v2_p012740.1|organism=Theobroma cacao|type=polypeptide|length=111bp MSSFLQSFLDPKKSWLAALHMKALSTRLRKYGLRYDDLYDPYYDLDIKEA LNRLPREIVDARNQRLKRAMDLSMKHKYLPKDLQAMQTPFRSYLQDMLAL VSSICYTAIL* back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
Term | Definition |
complete | complete |
Vocabulary: CC Evidence Code
Term | Definition |
IC_2 | IC_2 |
Vocabulary: Genedb Products
Term | Definition |
Cytochrome b-c1 complex subunit 7-1 | Cytochrome b-c1 complex subunit 7-1 |
Vocabulary: Biological Process
Term | Definition |
GO:0006122 | mitochondrial electron transport, ubiquinol to cytochrome c |
Vocabulary: Cellular Component
Term | Definition |
GO:0005750 | mitochondrial respiratory chain complex III |
|