|
Properties
Property Name | Value |
Note | Tc09v2_g006620~ Aldehyde dehydrogenase family 7 member A1~ unknown_gene~ fragment |
Product | aldehyde dehydrogenase family 7 member A1-like isoform X1 |
Cross References
External references for this polypeptide
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >Tc09v2_p006620.1 ID=Tc09v2_p006620.1|Name=Tc09v2_p006620.1|organism=Theobroma cacao|type=polypeptide|length=86bp MNNSVPLGLSSSIFTRRPEVIFKWIGPCGSDCGIVNVNIPTNGAEIGGAF GGEKATGGGREAGSDSCEINYGKELPLAQGINFVQ* back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
Term | Definition |
fragment | fragment |
Vocabulary: CC Evidence Code
Term | Definition |
IC_2 | IC_2 |
Vocabulary: Genedb Products
Term | Definition |
Aldehyde dehydrogenase family 7 member A1 | Aldehyde dehydrogenase family 7 member A1 |
Vocabulary: Molecular Function
Term | Definition |
GO:0016491 | oxidoreductase activity |
GO:0016620 | oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor |
Vocabulary: Biological Process
Term | Definition |
GO:0008152 | metabolic process |
GO:0055114 | oxidation-reduction process |
|