|
Overview
Name | Tc08v2_p015620.1 |
Unique Name | Tc08v2_p015620.1 |
Type | polypeptide |
Organism | Theobroma cacao (cacao) |
Sequence length | 115 |
Properties
Property Name | Value |
Note | Tc08v2_g015620~ V-type proton ATPase subunit G~ unknown_gene~ complete |
Product | V-type proton ATPase subunit G1 |
Cross References
External references for this polypeptide
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >Tc08v2_p015620.1 ID=Tc08v2_p015620.1|Name=Tc08v2_p015620.1|organism=Theobroma cacao|type=polypeptide|length=115bp MMATMEPFRRQGGIQMLLTAEQEAQHIVSSARCLKMARLKQAKEEAEKDV ALYRSHMETEYQKKISETSGSSGNTVKQLEEETDMKIKNLEESTSKVSKE IVDMLMKHITTVRT* back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
Term | Definition |
complete | complete |
Vocabulary: CC Evidence Code
Term | Definition |
IC_2 | IC_2 |
Vocabulary: Genedb Products
Term | Definition |
V-type proton ATPase subunit G | V-type proton ATPase subunit G |
Vocabulary: Molecular Function
Term | Definition |
GO:0016820 | hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of substances |
Vocabulary: Biological Process
Term | Definition |
GO:0015992 | proton transport |
Vocabulary: Cellular Component
Term | Definition |
GO:0016471 | vacuolar proton-transporting V-type ATPase complex |
|