|
Overview
Name | Tc08v2_p013760.1 |
Unique Name | Tc08v2_p013760.1 |
Type | polypeptide |
Organism | Theobroma cacao (cacao) |
Sequence length | 124 |
Properties
Property Name | Value |
Note | Tc08v2_g013760~ Probable carboxylesterase 18~ unknown_gene~ fragment |
Product | probable carboxylesterase 18 |
Cross References
External references for this polypeptide
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >Tc08v2_p013760.1 ID=Tc08v2_p013760.1|Name=Tc08v2_p013760.1|organism=Theobroma cacao|type=polypeptide|length=124bp MLSSGNLAHHVALKACEHEFSRLNLIGEVELQPFFGGEERTESEIKLVGT LLISVNRTDWMWKAFLPQGCNRDHQVVNVFGPNSVDISHLPFPPTLVFIS RFDPLQDWQRKYVEGLKKCGKTV* back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
Term | Definition |
fragment | fragment |
Vocabulary: CC Evidence Code
Term | Definition |
IC_2 | IC_2 |
Vocabulary: Genedb Products
Term | Definition |
Probable carboxylesterase 18 | Probable carboxylesterase 18 |
Vocabulary: Molecular Function
Term | Definition |
GO:0016787 | hydrolase activity |
Vocabulary: Biological Process
Term | Definition |
GO:0008152 | metabolic process |
|