|
Overview
Name | Tc08v2_p002550.1 |
Unique Name | Tc08v2_p002550.1 |
Type | polypeptide |
Organism | Theobroma cacao (cacao) |
Sequence length | 120 |
Properties
Property Name | Value |
Note | Tc08v2_g002550~ Inositol-pentakisphosphate 2-kinase family protein, putative isoform 1~ unknown_gene~ fragment |
Product | uncharacterized protein LOC108663126 |
Cross References
External references for this polypeptide
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >Tc08v2_p002550.1 ID=Tc08v2_p002550.1|Name=Tc08v2_p002550.1|organism=Theobroma cacao|type=polypeptide|length=120bp MSKKTILSVELLCPRCRQKVMKVISDVVGITSIVLDPSKNTVTVTGEADP VKIIKKVRKFRKHASIVSVAAAKDEKKDEKKVEKKDDRRDLVVYTPKTCH KCDVWYVVGDDLYTYCSIL* back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
Term | Definition |
fragment | fragment |
Vocabulary: CC Evidence Code
Term | Definition |
IC_2 | IC_2 |
Vocabulary: Genedb Products
Term | Definition |
Inositol-pentakisphosphate 2-kinase family protein, putative isoform 1 | Inositol-pentakisphosphate 2-kinase family protein, putative isoform 1 |
Vocabulary: Molecular Function
Term | Definition |
GO:0046872 | metal ion binding |
Vocabulary: Biological Process
Term | Definition |
GO:0030001 | metal ion transport |
|