|
Overview
Name | Tc06v2_p019840.3 |
Unique Name | Tc06v2_p019840.3 |
Type | polypeptide |
Organism | Theobroma cacao (cacao) |
Sequence length | 130 |
Properties
Property Name | Value |
Note | Tc06v2_g019840~ Acyl carrier protein 3, mitochondrial~ unknown_gene~ complete |
Product | acyl carrier protein 3, mitochondrial isoform X2 |
Cross References
External references for this polypeptide
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >Tc06v2_p019840.3 ID=Tc06v2_p019840.3|Name=Tc06v2_p019840.3|organism=Theobroma cacao|type=polypeptide|length=130bp MQSIRSAILRHVSMRESTGEWSFFTCGGNMFKLLRHQICTSTGASNAQIM DRVIGLVKKYDKIDASKVTETADFQKDLCLDSLDRVELVMAFEEEFSFEI PDEKADKLTCCADVAKYIVSRSGSDITKS* back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
Term | Definition |
complete | complete |
Vocabulary: CC Evidence Code
Term | Definition |
IC_2 | IC_2 |
Vocabulary: Genedb Products
Term | Definition |
Acyl carrier protein 3, mitochondrial | Acyl carrier protein 3, mitochondrial |
Vocabulary: Biological Process
Term | Definition |
GO:0006633 | fatty acid biosynthetic process |
|