|
Overview
Name | Tc05v2_p005670.1 |
Unique Name | Tc05v2_p005670.1 |
Type | polypeptide |
Organism | Theobroma cacao (cacao) |
Sequence length | 130 |
Properties
Property Name | Value |
Product | auxin-responsive protein SAUR71 |
Note | Tc05v2_g005670~ SAUR-like auxin-responsive protein family, putative (Fragment)~ unknown_gene~ fragment |
Cross References
External references for this polypeptide
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >Tc05v2_p005670.1 ID=Tc05v2_p005670.1|Name=Tc05v2_p005670.1|organism=Theobroma cacao|type=polypeptide|length=130bp MFRPFLQKIRKGFHVSLSRGQAVINDVEVDEEINVATPMSDDVEAGYFTV FAVQGKETQRFVIELDNLTNPAFLSLLEQAGEEYGFHQKGVLSLPCRPQE LQKILQDWEAEHADTEGWATCNATTTEGY* back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
Term | Definition |
fragment | fragment |
Vocabulary: CC Evidence Code
Term | Definition |
IC_2 | IC_2 |
Vocabulary: Genedb Products
Term | Definition |
SAUR-like auxin-responsive protein family, putative (Fragment) | SAUR-like auxin-responsive protein family, putative (Fragment) |
Vocabulary: Biological Process
Term | Definition |
GO:0009733 | response to auxin |
|