|
Overview
Name | Tc04v2_p016040.2 |
Unique Name | Tc04v2_p016040.2 |
Type | polypeptide |
Organism | Theobroma cacao (cacao) |
Sequence length | 112 |
Properties
Property Name | Value |
Product | uncharacterized protein LOC18602670 isoform X1 |
Note | Tc04v2_g016040~ Putative Cytoplasmic tRNA 2-thiolation protein 1~ unknown_gene~ fragment |
Cross References
External references for this polypeptide
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >Tc04v2_p016040.2 ID=Tc04v2_p016040.2|Name=Tc04v2_p016040.2|organism=Theobroma cacao|type=polypeptide|length=112bp MAAQEDQKDIKLPSDSIPEGWVLDTMVQDDGTEVQCYLCPPTDQRFYTYE DLMRYVRYAKRAKVSIYADNFWETVEKEDGFGPIKREGHSSNPLAGIKIR DIKGKSVVTSD* back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
Term | Definition |
fragment | fragment |
Vocabulary: CC Evidence Code
Term | Definition |
IC_3 | IC_3 |
Vocabulary: Genedb Products
Term | Definition |
Putative Cytoplasmic tRNA 2-thiolation protein 1 | Putative Cytoplasmic tRNA 2-thiolation protein 1 |
Vocabulary: Molecular Function
Term | Definition |
GO:0003677 | DNA binding |
Vocabulary: Cellular Component
Term | Definition |
GO:0005634 | nucleus |
|