|
Overview
Name | Tc04v2_p002850.1 |
Unique Name | Tc04v2_p002850.1 |
Type | polypeptide |
Organism | Theobroma cacao (cacao) |
Sequence length | 134 |
Properties
Property Name | Value |
Product | LOW QUALITY PROTEIN: putative calcium-binding protein CML19 |
Note | Tc04v2_g002850~ Putative calcium-binding protein CML19~ unknown_gene~ complete |
Cross References
External references for this polypeptide
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >Tc04v2_p002850.1 ID=Tc04v2_p002850.1|Name=Tc04v2_p002850.1|organism=Theobroma cacao|type=polypeptide|length=134bp MSKHPKYERVFNHFDENGDGKISPAELQQCVKAIGGELSLKEAGVVVEAL DSDEDGLLGLEDFVRLMEEVGEEETFKMYEMDRCGCITPKSLKRMLSRLR ESRTIEECELMIAQFDLNGDGVLNFDEFRVMML* back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
Term | Definition |
complete | complete |
Vocabulary: CC Evidence Code
Term | Definition |
IC_3 | IC_3 |
Vocabulary: Genedb Products
Term | Definition |
Putative calcium-binding protein CML19 | Putative calcium-binding protein CML19 |
Vocabulary: Molecular Function
Term | Definition |
GO:0005509 | calcium ion binding |
|