|
Overview
Name | Tc03v2_p002510.2 |
Unique Name | Tc03v2_p002510.2 |
Type | polypeptide |
Organism | Theobroma cacao (cacao) |
Sequence length | 107 |
Properties
Property Name | Value |
Note | Tc03v2_g002510~ NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10-B~ unknown_gene~ complete |
Product | NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10-B |
Cross References
External references for this polypeptide
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >Tc03v2_p002510.2 ID=Tc03v2_p002510.2|Name=Tc03v2_p002510.2|organism=Theobroma cacao|type=polypeptide|length=107bp MGRKKGVPEFDETAPDDFDPANPYKDPVAMLEMREHIVREKWIDIEKAKI LRDKVRWCYRIEGVNHLQKCRHLVRQYLDATRGIGWGKEGRHPSLHGPKV EEVESD* back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
Term | Definition |
complete | complete |
Vocabulary: CC Evidence Code
Term | Definition |
IC_2 | IC_2 |
Vocabulary: Genedb Products
Term | Definition |
NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10-B | NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10-B |
|