|
Overview
Name | Tc02v2_p005990.1 |
Unique Name | Tc02v2_p005990.1 |
Type | polypeptide |
Organism | Theobroma cacao (cacao) |
Sequence length | 118 |
Properties
Property Name | Value |
Note | Tc02v2_g005990~ NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9~ unknown_gene~ complete |
Product | NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 isoform X2 |
Cross References
External references for this polypeptide
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >Tc02v2_p005990.1 ID=Tc02v2_p005990.1|Name=Tc02v2_p005990.1|organism=Theobroma cacao|type=polypeptide|length=118bp MSGATTAAYLARRAAQKERVRILYRRALKDTLNWAVHRHLFYRDASDLRE KFEANKHVEDLDTIDRMIADGEATYNKWRHPDPYIVPWAPGGSKFTRNPV PPSGIEIAYDYGREDND* back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
Term | Definition |
complete | complete |
Vocabulary: CC Evidence Code
Term | Definition |
IC_2 | IC_2 |
Vocabulary: Genedb Products
Term | Definition |
NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 | NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 |
Vocabulary: Biological Process
Term | Definition |
GO:0006120 | mitochondrial electron transport, NADH to ubiquinone |
Vocabulary: Cellular Component
Term | Definition |
GO:0005747 | mitochondrial respiratory chain complex I |
|