|
Overview
Name | Tc01v2_p034450.1 |
Unique Name | Tc01v2_p034450.1 |
Type | polypeptide |
Organism | Theobroma cacao (cacao) |
Sequence length | 117 |
Properties
Property Name | Value |
Note | Tc01v2_g034450~ DNA-directed RNA polymerases II, IV and V subunit 11~ unknown_gene~ complete |
Product | DNA-directed RNA polymerases II, IV and V subunit 11 isoform X1 |
Cross References
External references for this polypeptide
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >Tc01v2_p034450.1 ID=Tc01v2_p034450.1|Name=Tc01v2_p034450.1|organism=Theobroma cacao|type=polypeptide|length=117bp MNAPDRYERFVVPEGTKKVSYERDTKIINAASFTIEREDHTIGNIVRMQL HRDENVLFAGYKLPHPLQYKIIVRIHTTSQSSPMQAYNQAINDLDKELDH LKNAFEAELAKHSRDY* back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
Term | Definition |
complete | complete |
Vocabulary: CC Evidence Code
Term | Definition |
IC_1 | IC_1 |
Vocabulary: Genedb Products
Term | Definition |
DNA-directed RNA polymerases II, IV and V subunit 11 | DNA-directed RNA polymerases II, IV and V subunit 11 |
Vocabulary: Molecular Function
Term | Definition |
GO:0003677 | DNA binding |
GO:0003899 | DNA-directed RNA polymerase activity |
GO:0046983 | protein dimerization activity |
Vocabulary: Biological Process
Term | Definition |
GO:0006351 | transcription, DNA-templated |
|