|
Overview
Name | Tc01v2_p033960.1 |
Unique Name | Tc01v2_p033960.1 |
Type | polypeptide |
Organism | Theobroma cacao (cacao) |
Sequence length | 127 |
Properties
Property Name | Value |
Note | Tc01v2_g033960~ Acyl carrier protein 1, mitochondrial~ unknown_gene~ complete |
Product | acyl carrier protein 1, mitochondrial |
Cross References
External references for this polypeptide
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >Tc01v2_p033960.1 ID=Tc01v2_p033960.1|Name=Tc01v2_p033960.1|organism=Theobroma cacao|type=polypeptide|length=127bp MALRAAVLRHIRVPVRTLAATGSKPQLQWSLCNSIRLFSSDDDHLTKEEV IDRVLDVVKSFPKVDPSKVTPHVHFQNDLGLDSLDNVEIVMALEEEFKLE IPDKEADKIDSCNLAIAYIYNHPMAG* back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
Term | Definition |
complete | complete |
Vocabulary: CC Evidence Code
Term | Definition |
IC_2 | IC_2 |
Vocabulary: Genedb Products
Term | Definition |
Acyl carrier protein 1, mitochondrial | Acyl carrier protein 1, mitochondrial |
Vocabulary: Biological Process
Term | Definition |
GO:0006633 | fatty acid biosynthetic process |
|