|
Overview
Name | Tc01v2_p022310.1 |
Unique Name | Tc01v2_p022310.1 |
Type | polypeptide |
Organism | Theobroma cacao (cacao) |
Sequence length | 131 |
Properties
Property Name | Value |
Product | V-type proton ATPase subunit F |
Note | Tc01v2_g022310~ V-type proton ATPase subunit F~ unknown_gene~ complete |
Cross References
External references for this polypeptide
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >Tc01v2_p022310.1 ID=Tc01v2_p022310.1|Name=Tc01v2_p022310.1|organism=Theobroma cacao|type=polypeptide|length=131bp MASRAQIPTSNSALIAMIADEDTVVGFLLAGVGNVDLRRKTNYLIVDSKT TVKQIEDAFKEFTAREDIAVVLISQYVANMIRFLVDSYNKPVPAILEIPS KDHPYDPAHDSVLSRVKYLFSAESVASGRR* back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
Term | Definition |
complete | complete |
Vocabulary: CC Evidence Code
Term | Definition |
IC_2 | IC_2 |
Vocabulary: Genedb Products
Term | Definition |
V-type proton ATPase subunit F | V-type proton ATPase subunit F |
Vocabulary: Molecular Function
Term | Definition |
GO:0046961 | proton-transporting ATPase activity, rotational mechanism |
Vocabulary: Biological Process
Term | Definition |
GO:0015991 | ATP hydrolysis coupled proton transport |
GO:0034220 | ion transmembrane transport |
Vocabulary: Cellular Component
Term | Definition |
GO:0033180 | proton-transporting V-type ATPase, V1 domain |
|