|
Overview
Name | Tc01v2_p006960.1 |
Unique Name | Tc01v2_p006960.1 |
Type | polypeptide |
Organism | Theobroma cacao (cacao) |
Sequence length | 100 |
Properties
Property Name | Value |
Product | cytochrome c oxidase subunit 6a, mitochondrial |
Note | Tc01v2_g006960~ Cytochrome c oxidase subunit 6a, mitochondrial~ unknown_gene~ complete |
Cross References
External references for this polypeptide
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >Tc01v2_p006960.1 ID=Tc01v2_p006960.1|Name=Tc01v2_p006960.1|organism=Theobroma cacao|type=polypeptide|length=100bp MAMASVRSGFLRTVLRGGSRPSATPKRGFASSSHHDDAYETAKWEKITYL GIATCTVLAIYNLSKGHHHHEEPPAYPYLHIRNKEFPWGPDGLFEEKHH* back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
Term | Definition |
complete | complete |
Vocabulary: CC Evidence Code
Term | Definition |
IC_2 | IC_2 |
Vocabulary: Genedb Products
Term | Definition |
Cytochrome c oxidase subunit 6a, mitochondrial | Cytochrome c oxidase subunit 6a, mitochondrial |
Vocabulary: Molecular Function
Term | Definition |
GO:0004129 | cytochrome-c oxidase activity |
Vocabulary: Cellular Component
Term | Definition |
GO:0005743 | mitochondrial inner membrane |
GO:0005751 | mitochondrial respiratory chain complex IV |
|