|
Overview
Name | Tc01v2_p006150.1 |
Unique Name | Tc01v2_p006150.1 |
Type | polypeptide |
Organism | Theobroma cacao (cacao) |
Sequence length | 128 |
Properties
Property Name | Value |
Product | formamidase-like |
Note | Tc01v2_g006150~ Acetamidase/Formamidase family protein isoform 1~ unknown_gene~ fragment |
Cross References
External references for this polypeptide
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >Tc01v2_p006150.1 ID=Tc01v2_p006150.1|Name=Tc01v2_p006150.1|organism=Theobroma cacao|type=polypeptide|length=128bp MAGYGARVVVPIDLKKKPWEQKHPLHNRWHPDIPAVAEVKEGELFRVEMV DFSGGGITKDYSADDVKHADPSIVSYSSIFCLSVSNSNFYCWCLKANTSM KNNSSKSNVRHKFTLLEHRTFPIDCKF* back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
Term | Definition |
fragment | fragment |
Vocabulary: CC Evidence Code
Term | Definition |
IC_2 | IC_2 |
Vocabulary: Genedb Products
Term | Definition |
Acetamidase/Formamidase family protein isoform 1 | Acetamidase/Formamidase family protein isoform 1 |
Vocabulary: Molecular Function
Term | Definition |
GO:0016811 | hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides |
|