|
Overview
Name | Tc01v2_p002570.1 |
Unique Name | Tc01v2_p002570.1 |
Type | polypeptide |
Organism | Theobroma cacao (cacao) |
Sequence length | 118 |
Properties
Property Name | Value |
Product | uncharacterized protein LOC18610877 |
Note | Tc01v2_g002570~ Heavy metal transport/detoxification superfamily protein, putative~ unknown_gene~ complete |
Cross References
External references for this polypeptide
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >Tc01v2_p002570.1 ID=Tc01v2_p002570.1|Name=Tc01v2_p002570.1|organism=Theobroma cacao|type=polypeptide|length=118bp MTVVDKIELDAAKGTITVTGDADPYELIVRKRKAEELVERVSVGPPPKQK QPTKPEEKKPEPKKDDKKPDPKKDGKKPETCPVCQQMSVVYMDRYAEPNM ACSITQSLMFNPFDICI* back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
Term | Definition |
complete | complete |
Vocabulary: CC Evidence Code
Term | Definition |
IC_1 | IC_1 |
Vocabulary: Genedb Products
Term | Definition |
Heavy metal transport/detoxification superfamily protein, putative | Heavy metal transport/detoxification superfamily protein, putative |
|