|
Overview
Name | Tc01v2_p000050.9 |
Unique Name | Tc01v2_p000050.9 |
Type | polypeptide |
Organism | Theobroma cacao (cacao) |
Sequence length | 109 |
Properties
Property Name | Value |
Product | AP-3 complex subunit sigma isoform X2 |
Note | Tc01v2_g000050~ AP-3 complex subunit sigma~ unknown_gene~ fragment |
Cross References
External references for this polypeptide
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >Tc01v2_p000050.9 ID=Tc01v2_p000050.9|Name=Tc01v2_p000050.9|organism=Theobroma cacao|type=polypeptide|length=109bp MVMNTHGKPRLAKFYEYLWKSSRSLHEAFLRVPISYQHSSSSSSSSYFSF LCCRAENVSNFIEAESIFGPDSRLLYKHFATLDFVVVYSSEIELAVLDLI QDMLSWMR* back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
Term | Definition |
fragment | fragment |
Vocabulary: CC Evidence Code
Term | Definition |
IC_2 | IC_2 |
Vocabulary: Genedb Products
Term | Definition |
AP-3 complex subunit sigma | AP-3 complex subunit sigma |
Vocabulary: Molecular Function
Term | Definition |
GO:0008565 | protein transporter activity |
Vocabulary: Cellular Component
Term | Definition |
GO:0030123 | AP-3 adaptor complex |
|