|
Overview
Name | Tc01v2_p000040.12 |
Unique Name | Tc01v2_p000040.12 |
Type | polypeptide |
Organism | Theobroma cacao (cacao) |
Sequence length | 114 |
Properties
Property Name | Value |
Product | AP-3 complex subunit sigma |
Note | Tc01v2_g000040~ Hypothetical protein~ unknown_gene~ missing_functional_completeness |
Cross References
External references for this polypeptide
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >Tc01v2_p000040.12 ID=Tc01v2_p000040.12|Name=Tc01v2_p000040.12|organism=Theobroma cacao|type=polypeptide|length=114bp MLQISVEKQQELIGSVSQDSCLVYKHFATLYFVLVFDSSENELAELDLIQ DKKTFHKAEASHFDGFCDDLKLHSVQIHLFVEYILLYEHLLNTIKLMFMC TGTSDHCCVTQLS* back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
Term | Definition |
missing_functional_completeness | missing_functional_completeness |
Vocabulary: CC Evidence Code
Term | Definition |
IC_5 | IC_5 |
Vocabulary: Genedb Products
Term | Definition |
Hypothetical protein | Hypothetical protein |
Vocabulary: Cellular Component
Term | Definition |
GO:0030117 | membrane coat |
GO:0030123 | AP-3 adaptor complex |
Vocabulary: Molecular Function
Term | Definition |
GO:0008565 | protein transporter activity |
|